| Description | Purity ≥95%. Source: Recombinant Human from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: P23297 Fragment: Met1~Ser94 (Accession No: P23297) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MGSELETAME TLINVFHAHS GKEGDKYKLS KKELKELLQT ELSGFLDAQK DVDAVDKVMK ELDENGDGEV DFQEYVVLVA ALTVACNNFF WENS Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 16.3kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. |