| Edit |   |
|---|
| Antigenic Specificity | TRAF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TRAF6 Antibody |
|---|
| Immunogen | The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA |
|---|
| Other Names | MGC:3310, RNF85, TNF receptor-associated factor 6, E3 ubiquitin protein ligase |
|---|
| Gene, Accession # | TRAF6, Accession: NM_004620 |
|---|
| Catalog # | TA329145 |
|---|
| Price | |
|---|
| Order / More Info | TRAF6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|