| Edit |   |
| Antigenic Specificity | Dual specificity phosphatase 7 |
| Clone | AFFN-DUSP7-14G9 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b |
| Format | supernatant |
| Size | 1.0 ml |
| Concentration | n/a |
| Applications | ELISA, Microarray |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Epitope: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET. This antibody recognizes a phosphatase that dephosphorylates both tyrosine and serine/threonine residues. The N-terminal region of DUSP7 contains a Cdc25-like (CH2) domain. |
| Immunogen | Recombinant peptide: a.a. 51-90 |
| Other Names | MKP-X, PYST2 |
| Gene, Accession # | DUSP7, Gene ID: 1849, UniProt: Q16829 |
| Catalog # | AFFN-DUSP7-14G9 |
| Price | |
| Order / More Info | Dual specificity phosphatase 7 Antibody from DEVELOPMENTAL STUDIES HYBRIDOMA BANK |
| Product Specific References | PubMed: 21572409, 17195019 |