| Edit |   |
|---|
| Antigenic Specificity | Nova1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nova1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nova1. This antibody reacts with human. The Nova1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NOVA1(neuro-oncological ventral antigen 1) The peptide sequence was selected from the C terminal of NOVA1. Peptide sequence SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG. |
|---|
| Other Names | neuro-oncological ventral antigen 1Nova-1, Onconeural ventral antigen 1, Paraneoplastic Ri antigen, RNA-binding protein Nova-1, Ventral neuron-specific protein 1 |
|---|
| Gene, Accession # | NOVA1, Gene ID: 4857, Accession: A8K603, SwissProt: A8K603 |
|---|
| Catalog # | NBP1-57397 |
|---|
| Price | |
|---|
| Order / More Info | Nova1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|