| Edit |   |
| Antigenic Specificity | ORAI3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, bovine, dog, porcine, horse, mouse, rat, guinea pig, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-ORAI3 Antibody |
| Immunogen | The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY |
| Other Names | TMEM142C, ORAI calcium release-activated calcium modulator 3 |
| Gene, Accession # | ORAI3, Accession: NM_152288 |
| Catalog # | TA337882 |
| Price | |
| Order / More Info | ORAI3 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |