| Edit |   |
| Antigenic Specificity | CCL14/HCC-1/HCC-3 |
| Clone | 1F12 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCL14/HCC-1/HCC-3 Antibody (1F12) from Novus Biologicals is a mouse monoclonal antibody to CCL14/HCC-1/HCC-3. This antibody reacts with human. The CCL14/HCC-1/HCC-3 Antibody (1F12) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | CCL14 (AAH45165, 20 a.a. - 93 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Other Names | C-C motif chemokine 14, chemokine (C-C motif) ligand 14, Chemokine CC-1/CC-3, chemokine CC-3, CKB1, FLJ16015, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, hemofiltrate CC chemokine 1, MCIF, member 14, NCC2CC-1, NCC-2CKb1, new CC chemokine 2, SCYA14CC-3, Small-inducible cytokine A14 |
| Gene, Accession # | CCL14, Gene ID: 6358, Accession: AAH45165, SwissProt: AAH45165 |
| Catalog # | H00006358-M01 |
| Price | |
| Order / More Info | CCL14/HCC-1/HCC-3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |