| Edit |   |
| Antigenic Specificity | AASDH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AASDH Antibody from Novus Biologicals is a rabbit polyclonal antibody to AASDH. This antibody reacts with human. The AASDH Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AASDH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKLSDINQEEASGTSLHQKAIMTFTCHNEINAFVVLSRGSQILSLNSTRFLTKLGHCSSACPSDSVSQTNIQNLKGLNSPVLIGKSKDPSCV |
| Other Names | ACSF4acyl-CoA synthetase family member 4, aminoadipate-semialdehyde dehydrogenase, EC 6.2.1.-, LYS2, non-ribosomal peptide synthetase 1098, non-ribosomal peptide synthetase 998,2-aminoadipic 6-semialdehyde dehydrogenase, NRPS1098, NRPS998, Protein NRPS998, U26 |
| Gene, Accession # | AASDH, Gene ID: 132949, Accession: Q4L235, SwissProt: Q4L235 |
| Catalog # | NBP1-89266 |
| Price | |
| Order / More Info | AASDH Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |