| Edit |   |
| Antigenic Specificity | AASD-PPT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AASD-PPT Antibody from Novus Biologicals is a rabbit polyclonal antibody to AASD-PPT. This antibody reacts with human. The AASD-PPT Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to AASD-PPT. The peptide sequence was selected from the C terminal of AASDHPPT. Peptide sequence SRHQDVPSQDDSKPTQRQFTILNFNDLMSSAVPMTPE |
| Other Names | 4'-phosphopantetheinyl transferase, AASD-PPTDKFZp566E2346, Alpha-aminoadipic semialdehyde dehydrogenase-phosphopantetheinyl transferase, aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, CGI-80, EC 2.7.8, EC 2.7.8.-, L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase, LYS2, LYS5, LYS5 ortholog |
| Gene, Accession # | AASDHPPT, Gene ID: 60496, Accession: Q9NRN7, SwissProt: Q9NRN7 |
| Catalog # | NBP1-54977 |
| Price | |
| Order / More Info | AASD-PPT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |