| Edit |   |
| Antigenic Specificity | KRR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat, dog, porcine, rabbit, guinea pig, bovine, zebrafish, horse, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-KRR1 Antibody |
| Immunogen | The immunogen for anti-KRR1 antibody: synthetic peptide directed towards the C terminal of human KRR1. Synthetic peptide located within the following region: KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET |
| Other Names | HRB2, RIP1, KRR1, small subunit (SSU) processome component, homolog (yeast) |
| Gene, Accession # | KRR1, Accession: NM_007043 |
| Catalog # | TA345997 |
| Price | |
| Order / More Info | KRR1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |