| Edit |   |
|---|
| Antigenic Specificity | ZXDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, human, rat, dog, bovine, porcine, rabbit, guinea pig, horse, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-ZXDC Antibody |
|---|
| Immunogen | The immunogen for anti-ZXDC antibody: synthetic peptide directed towards the middle region of human ZXDC. Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | ZXDC, Accession: NM_001040653 |
|---|
| Catalog # | TA339665 |
|---|
| Price | |
|---|
| Order / More Info | ZXDC Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|