| Edit |   |
| Antigenic Specificity | KRT13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, horse, dog, porcine, mouse, rat, sheep, bovine, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-KRT13 Antibody |
| Immunogen | The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the N terminal of human KRT13. Synthetic peptide located within the following region: TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY |
| Other Names | n/a |
| Gene, Accession # | K1C13, Accession: NM_002274 |
| Catalog # | TA346320 |
| Price | |
| Order / More Info | KRT13 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |