| Edit |   |
| Antigenic Specificity | PARL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat, human, mouse, dog, porcine, horse, rabbit, guinea |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB,IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PARL Antibody |
| Immunogen | The immunogen for Anti-PARL Antibody: synthetic peptide directed towards the N terminal of human PARL. Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ |
| Other Names | PSARL, PSARL1, PSENIP2, RHBDS1, presenilin associated, rhomboid-like |
| Gene, Accession # | PARL, Accession: NM_001037639 |
| Catalog # | TA336006 |
| Price | |
| Order / More Info | PARL Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |