| Edit |   |
| Antigenic Specificity | PARP16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog, horse, rabbit, rat, mouse, porcine, bovine |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-PARP16 Antibody |
| Immunogen | The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the middle region of human PARP16. Synthetic peptide located within the following region: PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL |
| Other Names | ARTD15, C15orf30, pART15, poly (ADP-ribose) polymerase family, member 16 |
| Gene, Accession # | PAR16, Accession: NM_017851 |
| Catalog # | TA334257 |
| Price | |
| Order / More Info | PARP16 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |