| Edit |   |
| Antigenic Specificity | beta-Site APP-Cleaving Enzyme 1 (BACE) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi. |
| Immunogen | BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
| Other Names | BACE1|MGC145931|bace2|MGC68881|MGC68482|BACE2|C76936|Bace|ASP2|BACE|HSPC104|zgc:77409 |
| Gene, Accession # | Gene ID: 23621,23821,29392 |
| Catalog # | ABIN635849 |
| Price | |
| Order / More Info | beta-Site APP-Cleaving Enzyme 1 (BACE) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |