| Edit |   |
| Antigenic Specificity | Estrogen Receptor 1 (ESR1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. |
| Immunogen | Estrogen Receptor 1 antibody was raised using the middle region of ESR1 corresponding to a region with amino acids LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAE |
| Other Names | ACTGP1|ACT1GP1|HY-psi-gamma-AC6|ER[b]2|ER[b]a|zfER[b]2|zfER-beta2|XER|era|esr|esra|nr3a1|ERbeta|xesr-1|ERalpha|xlERalpha1|xlERalpha2|LOC398733|LOC398734|2610524P08Rik|9130407C09Rik|AU019798|Era|M-ERA|MERA-S|MERA-W|ERA|ERAL1A|H-ERA|HERA-A|HERA-B|er|esr1|ER|ESR|ESRA|ESTRR|NR3A1|ER-alpha|Esr|RNESTROR|ERALPHA|ER[a]|eralpha|zfER[a]|ESR1|AA420328|AU041214|ERa|Estr|Estra|Nr3a1 |
| Gene, Accession # | Gene ID: 2099 |
| Catalog # | ABIN634254 |
| Price | |
| Order / More Info | Estrogen Receptor 1 (ESR1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |