| Edit |   |
|---|
| Antigenic Specificity | CCT6A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (antigen sequence identity: mouse 92%, rat 100%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 μl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CCT6A polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK |
|---|
| Other Names | chaperonin containing TCP1, subunit 6A (zeta 1), CCT6, Cctz, HTR3, TCP20, TCPZ, TTCP20 |
|---|
| Gene, Accession # | Gene ID: 908, UniProt: P40227, ENSG00000146731 |
|---|
| Catalog # | HPA042996 |
|---|
| Price | |
|---|
| Order / More Info | CCT6A Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|