| Edit |   |
| Antigenic Specificity | COX8C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 40%, rat 35%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human COX8C polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE |
| Other Names | cytochrome c oxidase subunit VIIIC, COX8-3 |
| Gene, Accession # | Gene ID: 341947, UniProt: Q7Z4L0, ENSG00000187581 |
| Catalog # | HPA003127 |
| Price | |
| Order / More Info | COX8C Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |